Skip navigation

Chemical bombestatin, Bombina maxima

Name bombestatin, Bombina maxima
Equivalent Term WEVLLNVALIRLELLSCRSSKDQDQKESCGMHSW
Curation Status No associations have been curated for this chemical yet.
MeSH® ID C510988
External Links

Top ↑ Ancestors

1. ChemicalsHormones, Hormone Substitutes, and Hormone Antagonists Has associated genes Has associated diseases Has associated exposure references Hormones Has associated genes Has associated diseases Has associated exposure references Peptide Hormones Has associated genes Has associated diseases Has associated exposure references Bombesin Has associated genes Has associated diseases bombestatin, Bombina maxima
2. ChemicalsAmino Acids, Peptides, and Proteins Has associated genes Has associated diseases Has associated exposure references Peptides Has associated genes Has associated diseases Has associated exposure references Neuropeptides Has associated genes Has associated diseases Bombesin Has associated genes Has associated diseases bombestatin, Bombina maxima
3. ChemicalsAmino Acids, Peptides, and Proteins Has associated genes Has associated diseases Has associated exposure references Peptides Has associated genes Has associated diseases Has associated exposure references Peptide Hormones Has associated genes Has associated diseases Has associated exposure references Bombesin Has associated genes Has associated diseases bombestatin, Bombina maxima
4. ChemicalsComplex Mixtures Has associated genes Has associated diseases Has associated exposure references Venoms Has associated genes Has associated diseases Amphibian Venoms Has associated genes Has associated diseases Bombesin Has associated genes Has associated diseases bombestatin, Bombina maxima
5. ChemicalsBiological Factors Has associated genes Has associated diseases Has associated exposure references Toxins, Biological Has associated genes Has associated diseases Has associated exposure references Venoms Has associated genes Has associated diseases Amphibian Venoms Has associated genes Has associated diseases Bombesin Has associated genes Has associated diseases bombestatin, Bombina maxima

Top ↑ Descendants

None.