Skip navigation

Chemical p66 - pituitary adenylate cyclase-activating peptide analog

Name p66 - pituitary adenylate cyclase-activating peptide analog
Equivalent Term HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY
Curation Status No associations have been curated for this chemical yet.
MeSH® ID C529639
External Links

Top ↑ Ancestors

1. ChemicalsAmino Acids, Peptides, and Proteins Has associated genes Has associated diseases Has associated exposure references Peptides Has associated genes Has associated diseases Has associated exposure references Neuropeptides Has associated genes Has associated diseases Pituitary Adenylate Cyclase-Activating Polypeptide p66 - pituitary adenylate cyclase-activating peptide analog
2. ChemicalsBiological Factors Has associated genes Has associated diseases Has associated exposure references Intercellular Signaling Peptides and Proteins Has associated genes Has associated diseases Nerve Growth Factors Has associated genes Has associated diseases Pituitary Adenylate Cyclase-Activating Polypeptide p66 - pituitary adenylate cyclase-activating peptide analog

Top ↑ Descendants

None.