Skip navigation

Chemical cecropin A(1-7)-melittin(2-12)-Tat(47-57) peptide

Name cecropin A(1-7)-melittin(2-12)-Tat(47-57) peptide
Equivalent Terms CM(18)-Tat(11) peptide | CM18-Tat11 peptide | KWKLFKKIGAVLKVLTTG-YGRKKRRQRRR
Curation Status No associations have been curated for this chemical yet.
MeSH® ID C586882
External Links

Top ↑ Ancestors

ChemicalsAmino Acids, Peptides, and Proteins Has associated genes Has associated diseases Has associated exposure references Peptides Has associated genes Has associated diseases Has associated exposure references Cell-Penetrating Peptides Has associated genes Has associated diseases cecropin A(1-7)-melittin(2-12)-Tat(47-57) peptide

Top ↑ Descendants

None.