Skip navigation

Chemical cecropin A(1-7)-melittin(2-12)-Tat(47-57) peptide

Name cecropin A(1-7)-melittin(2-12)-Tat(47-57) peptide
Equivalent Terms CM(18)-Tat(11) peptide | CM18-Tat11 peptide | KWKLFKKIGAVLKVLTTG-YGRKKRRQRRR
Curation Status No associations have been curated for this chemical yet.
MeSH® ID C586882
External Links

Top ↑ Ancestors

ChemicalsAmino Acids, Peptides, and Proteins Has associated genes Has associated diseases Has associated phenotype references Has associated exposure references Peptides Has associated genes Has associated diseases Has associated phenotype references Has associated exposure references Cell-Penetrating Peptides Has associated genes Has associated diseases Has associated phenotype references cecropin A(1-7)-melittin(2-12)-Tat(47-57) peptide

Top ↑ Descendants

None.